PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00833.1.p
Common NameLOC105955786, MIMGU_mgv1a012725mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Dof
Protein Properties Length: 243aa    MW: 24891.7 Da    PI: 9.0439
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00833.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-382382362
            zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       ++l+cprCdst+tkfCyynny+ sqPr+fCk+CrryWt+GG+lr++P+Ggg+rk+ k+s
  Migut.K00833.1.p 23 PEHLPCPRCDSTHTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPIGGGTRKSAKRS 82
                      57899**************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-281980IPR003851Zinc finger, Dof-type
PfamPF027011.1E-322580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8452680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MATDTSERKL AKAGHVGAPA PEPEHLPCPR CDSTHTKFCY YNNYNFSQPR HFCKSCRRYW  60
THGGTLRDIP IGGGTRKSAK RSRTTIVSSA TSGSSAATSF SSAAAHQYRD FGHFPAAASQ  120
LLVPFAAAAD HGGYMPFSSD VAKMGGSFTS LLNSNHGGGG GILALGGFGL GLDDVGFGLG  180
RAAAAWPFPG VVEGRPGGGN GGGSSGGGHT WQMENGQGGF MGGGDCFAFP DLAISTPGRV  240
LK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629225e-72KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012835034.11e-177PREDICTED: dof zinc finger protein DOF3.4-like isoform X1
SwissprotQ390881e-51DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A022RHY31e-177A0A022RHY3_ERYGU; Uncharacterized protein
STRINGPOPTR_0007s11790.11e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-41Dof family protein